PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1AL_91299CB97.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 249aa    MW: 26989.2 Da    PI: 9.7781
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1AL_91299CB97.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.83.8e-163885148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g+WT eEd+ l+++v+  G g W++ ar  g++Rt+k+c++rw++yl
  Traes_1AL_91299CB97.1 38 KGPWTMEEDLVLANYVAANGEGAWNSLARAAGLNRTGKSCRLRWLNYL 85
                           79********************************************97 PP

2Myb_DNA-binding569.4e-1891134146
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            rg+ T+eE++l+v++ +++G++ W++Iar+++ gRt++++k++w++
  Traes_1AL_91299CB97.1  91 RGNITPEEHLLIVELQARWGNR-WSKIARHLP-GRTDNEIKNFWRT 134
                            7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.5643385IPR017930Myb domain
SuperFamilySSF466891.31E-2936132IPR009057Homeodomain-like
SMARTSM007172.9E-113787IPR001005SANT/Myb domain
PfamPF002491.5E-143885IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-213992IPR009057Homeodomain-like
CDDcd001673.42E-84085No hitNo description
PROSITE profilePS5129424.63886140IPR017930Myb domain
SMARTSM007177.5E-1590138IPR001005SANT/Myb domain
PfamPF002493.0E-1591134IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.1E-2293139IPR009057Homeodomain-like
CDDcd001672.99E-1295134No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0080086Biological Processstamen filament development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MRNAAVFTLA TALRRRSGTR APEGRRRTMQ CAEPAVRKGP WTMEEDLVLA NYVAANGEGA  60
WNSLARAAGL NRTGKSCRLR WLNYLRPDVR RGNITPEEHL LIVELQARWG NRWSKIARHL  120
PGRTDNEIKN FWRTKIQKKR SGGATASDST GCQLPSSTAV TESQSSSSNS VGRPGAMPHY  180
DVVTAATQPG GWGDHQLGYA VQGGGGAACA GDMDGGVPPE FLQAAAVAGD NFWGLEEFWP  240
TVPSLHGDY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-242713916127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0036073e-58AP003607.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0004A09.
GenBankAP0043673e-58AP004367.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0696E01.
GenBankAP0149573e-58AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAY4593383e-58AY459338.1 Oryza sativa (japonica cultivar-group) clone CL029396.2 R2R3-MYB gene region.
GenBankCP0126093e-58CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006655601.27e-83PREDICTED: myb-related protein 340-like
SwissprotQ9LK959e-73MYB21_ARATH; Transcription factor MYB21
TrEMBLW4ZQZ80.0W4ZQZ8_WHEAT; Uncharacterized protein
STRINGMLOC_68593.11e-101(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27810.11e-67myb domain protein 21
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]